PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AA32G01100
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Aethionemeae; Aethionema
Family NAC
Protein Properties Length: 286aa    MW: 31851.7 Da    PI: 8.551
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AA32G01100genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM169.41.1e-52141391128
         NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgel 99 
                 lppGfrF Ptdeel+v+yL++kv+g +++l +vi e+d+yk++PwdLp+k+  +ekewyfFs+rd+ky++g+r+nr++ sgyWkatg+dk ++s +g+ 
  AA32G01100  14 LPPGFRFYPTDEELLVQYLCRKVAGCQFSL-QVIGEIDLYKFDPWDLPSKALFGEKEWYFFSPRDRKYPNGSRPNRVAGSGYWKATGTDKIITS-DGHR 110
                 79***************************9.99***************8777899***********************************9999.999* PP

         NAM 100 vglkktLvfykgrapkgektdWvmheyrl 128
                 vg+kk Lvfy g+apkg+kt+W+mheyrl
  AA32G01100 111 VGIKKALVFYAGKAPKGTKTNWIMHEYRL 139
                 ***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019418.37E-689163IPR003441NAC domain
PROSITE profilePS5100560.91714162IPR003441NAC domain
PfamPF023654.8E-2615139IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009414Biological Processresponse to water deprivation
GO:0009737Biological Processresponse to abscisic acid
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 286 aa     Download sequence    Send to blast
MGVREKDPLA QLSLPPGFRF YPTDEELLVQ YLCRKVAGCQ FSLQVIGEID LYKFDPWDLP  60
SKALFGEKEW YFFSPRDRKY PNGSRPNRVA GSGYWKATGT DKIITSDGHR VGIKKALVFY  120
AGKAPKGTKT NWIMHEYRLI ENSRSHGSSK LDDWVLCRIY KKNSGSQKQA TVQACVEEQS  180
MNGSSSSSSS QVDDVLDSFL EEKSFNLPRM NSLRTILNGN FDWASLAGLN PISELTSTNE  240
LLSYNSYDTS GLKNSSGLTQ SLNLGSGFES FGYGLSGQTG GFGFRQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A1e-10811684171NO APICAL MERISTEM PROTEIN
1ut4_B1e-10811684171NO APICAL MERISTEM PROTEIN
1ut7_A1e-10811684171NO APICAL MERISTEM PROTEIN
1ut7_B1e-10811684171NO APICAL MERISTEM PROTEIN
3swm_A1e-10811687174NAC domain-containing protein 19
3swm_B1e-10811687174NAC domain-containing protein 19
3swm_C1e-10811687174NAC domain-containing protein 19
3swm_D1e-10811687174NAC domain-containing protein 19
3swp_A1e-10811687174NAC domain-containing protein 19
3swp_B1e-10811687174NAC domain-containing protein 19
3swp_C1e-10811687174NAC domain-containing protein 19
3swp_D1e-10811687174NAC domain-containing protein 19
4dul_A1e-10811684171NAC domain-containing protein 19
4dul_B1e-10811684171NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010438620.11e-167PREDICTED: NAC domain-containing protein 72-like
SwissprotQ93VY31e-168NAC72_ARATH; NAC domain-containing protein 72
TrEMBLA0A0A1EIC11e-164A0A0A1EIC1_OLIPU; NAC026
STRINGAT4G27410.31e-160(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM14352795
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G27410.21e-168NAC family protein